ZNDR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25539625UL

Catalog No. NB395028

Description

ZNDR1 Polyclonal specifically detects ZNDR1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ZNDR1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: DNA-directed RNA polymerase I subunit RPA12, HTEX-6, hZR14, MGC13376, RNA polymerase I small specific subunit Rpa12, Rpa12, tctex-6, TEX6, transcription-associated zinc ribbon protein, zinc ribbon domain containing 1, zinc ribbon domain containing, 1, Zinc ribbon domain-containing protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ZNRD1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCT
• Quantity: 25 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 30834
• Target Species: Human
• Isotype: IgG

For Research Use Only