ZNF12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180276

Catalog No. NBP180276

Description

ZNF12 Polyclonal specifically detects ZNF12 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF12
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GIOT3, Gonadotropin-inducible ovary transcription repressor 3, HZF11, zinc finger protein 11, zinc finger protein 12, Zinc finger protein 325GIOT-3KOX3gonadotropin inducible transcription repressor 3, Zinc finger protein KOX3, ZNF325
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7559
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_057349
• Gene Symbols: ZNF12
• Immunogen: Synthetic peptide directed towards the N terminal of human ZNF12. Peptide sequence: ADECSGCGKSLLHIKLEKTHPGDQAYEFNQNGEPYTLNEESLYQKIRILE
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 85%; Equine: 78%.
• Target Species: Human, Rat, Canine, Equine
• Form: Purified