Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
ZNF12 Polyclonal specifically detects ZNF12 in Human samples. It is validated for Western Blot.Specifications
ZNF12 | |
Polyclonal | |
Purified | |
RUO | |
GIOT3, Gonadotropin-inducible ovary transcription repressor 3, HZF11, zinc finger protein 11, zinc finger protein 12, Zinc finger protein 325GIOT-3KOX3gonadotropin inducible transcription repressor 3, Zinc finger protein KOX3, ZNF325 | |
ZNF12 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
NP_057349 | |
7559 | |
Synthetic peptide directed towards the N terminal of human ZNF12. Peptide sequence: ADECSGCGKSLLHIKLEKTHPGDQAYEFNQNGEPYTLNEESLYQKIRILE | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title