Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZNF286 Antibody, Novus Biologicals™

ZNF286 Antibody, Novus Biologicals™
SDP

Catalog No. NB8011920UL Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB8011920UL 20 μL
NBP180119 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB8011920UL Supplier Novus Biologicals Supplier No. NBP18011920UL

Description

Rabbit Polyclonal Antibody

ZNF286 Polyclonal specifically detects ZNF286 in Human samples. It is validated for Western Blot.

Specifications

Antigen ZNF286
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_065703
Gene Alias MGC149627, zinc finger protein 286, zinc finger protein 286A
Gene Symbols ZNF286A
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human ZNF286. Peptide sequence GALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGK.
Molecular Weight of Antigen 60 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57335
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.