Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF334 Antibody, Novus Biologicals™
SDP

Catalog No. NBP179707 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179707 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP179707 Supplier Novus Biologicals Supplier No. NBP179707
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ZNF334 Polyclonal specifically detects ZNF334 in Human samples. It is validated for Western Blot.

Specifications

Antigen ZNF334
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_060572
Gene Alias DKFZp586G1122, Hzf, HZFzinc finger protein 385, RZFHematopoietic zinc finger protein, ZFP385, zinc finger protein 385A, ZNF385Retinal zinc finger protein
Gene Symbols ZNF334
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human ZNF334The immunogen for this antibody is ZNF334. Peptide sequence KMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGY.
Molecular Weight of Antigen 80 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55713
Test Specificity Expected identity based on immunogen sequence: Sumatran orangutan: 100%; Rabbit: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.