Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF334 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF334 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF334 Polyclonal specifically detects ZNF334 in Human samples. It is validated for Western Blot.Specifications
ZNF334 | |
Polyclonal | |
Rabbit | |
NP_060572 | |
55713 | |
Synthetic peptide directed towards the N terminal of human ZNF334The immunogen for this antibody is ZNF334. Peptide sequence KMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGY. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp586G1122, Hzf, HZFzinc finger protein 385, RZFHematopoietic zinc finger protein, ZFP385, zinc finger protein 385A, ZNF385Retinal zinc finger protein | |
ZNF334 | |
IgG | |
80 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title