Learn More
Description
Specifications
Specifications
| Antigen | ZNF354A |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | G0/G1 switch regulatory protein 24, G0S24tristetraprolin, Growth factor-inducible nuclear protein NUP475, NUP475, Protein TIS11A, RNF162Atristetraproline, TIS11A, TIS11zfp-36, TTPGOS24, Zfp-36, Zinc finger protein 36 homolog, zinc finger protein 36, C3H type, homolog (mouse), zinc finger protein, C3H type, 36 homolog, zinc finger protein, C3H type, 36 homolog (mouse) |
| Gene Symbols | ZNF354A |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: TQDSSFQGLILKRSNRNVPWDLKLEKPYIYEGRLEKKQDKKGSFQIVSATHKKIPTIERSHKNTELSQNFSPKSVLIRQQILPR |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
