Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF382 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP18038020UL

View more versions of this product

Catalog No. NBP18038020

Description

ZNF382 Polyclonal specifically detects ZNF382 in Human samples. It is validated for Western Blot.

Specifications

Antigen	ZNF382
Classification	Polyclonal
Dilution	Western Blot 1:1000
Gene Accession No.	NP_116214
Gene Symbols	ZNF382
Immunogen	Synthetic peptide directed towards the N terminal of human ZNF382. Peptide sequence MPLQGSVSFKDVTVDFTQEEWQQLDPAQKALYRDVMLENYCHFVSVGFHM.
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	zinc finger protein 382
Host Species	Rabbit
Purification Method	Protein A purified
Regulatory Status	RUO
Gene ID (Entrez)	84911
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

ZNF382 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions