Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF382 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | ZNF382 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180380
![]() |
Novus Biologicals
NBP180380 |
100 μL |
Each for $499.50
|
|
|||||
NBP18038020
![]() |
Novus Biologicals
NBP18038020UL |
20 μL | N/A | N/A | N/A | ||||
Description
ZNF382 Polyclonal specifically detects ZNF382 in Human samples. It is validated for Western Blot.Specifications
ZNF382 | |
Polyclonal | |
Purified | |
RUO | |
zinc finger protein 382 | |
ZNF382 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
NP_116214 | |
84911 | |
Synthetic peptide directed towards the N terminal of human ZNF382. Peptide sequence MPLQGSVSFKDVTVDFTQEEWQQLDPAQKALYRDVMLENYCHFVSVGFHM. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title