ZNF385B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179420

Catalog No. NBP179420

Description

ZNF385B Polyclonal specifically detects ZNF385B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF385B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C2H2-like zinc finger protein rearranged in thyroid adenomas, DKFZp686L0787, KRAB zinc finger protein, zinc finger protein 331, Zinc finger protein 463, ZNF463RITAZNF361Zinc finger protein 361
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001106869
• Gene Symbols: ZNF385B
• Immunogen: Synthetic peptide directed towards the C terminal of human ZNF385BThe immunogen for this antibody is ZNF385B. Peptide sequence HVNSEIQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 151126
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG