Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF398 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP25726025UL

View more versions of this product

Catalog No. NB435396

$382.00 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

ZNF398 Polyclonal specifically detects ZNF398 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	ZNF398
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias	KIAA0961zinc finger protein 30 homolog, zfp-30, zinc finger protein 30 homolog (mouse), Zinc finger protein 745, ZNF745Zfp-30
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	57541
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols	ZNF398
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GRSFRYKQTLKDHLRSGHNGGCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWYG
Quantity	25 μL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

ZNF398 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions