ZNF420 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156920

Catalog No. NBP156920

Description

ZNF420 Polyclonal specifically detects ZNF420 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF420
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ20086, KIAA1584, MGC21637, MGC61687, SUHW4, Suppressor of hairy wing homolog 4, zinc finger protein 280D, Zinc finger protein 634, ZNF634suppressor of hairy wing homolog 4 (Drosophila)
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 147923
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TAQ5
• Gene Symbols: ZNF420
• Immunogen: Synthetic peptides corresponding to ZNF420(zinc finger protein 420) The peptide sequence was selected from the N terminal of ZNF420. Peptide sequence LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Canine, Equine
• Isotype: IgG

For Research Use Only