Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF433 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF433 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF433 Polyclonal specifically detects ZNF433 in Human samples. It is validated for Western Blot.Specifications
ZNF433 | |
Polyclonal | |
Rabbit | |
NP_001073880 | |
163059 | |
Synthetic peptide directed towards the N terminal of human ZNF433The immunogen for this antibody is ZNF433. Peptide sequence GEVGSAHSSLNRHIRDDTGHKAYEYQEYGQKPYKCKYCKKPFNCLSSVQT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ38685, FLJ77809, MGC45417, zfp-276, ZFP276MGC126480, zinc finger protein 276, zinc finger protein 276 homolog, zinc finger protein 276 homolog (mouse), Zinc finger protein 477, ZNF477MGC111410 | |
ZNF433 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title