ZNF468 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179437

Catalog No. NBP179437

Description

ZNF468 Polyclonal specifically detects ZNF468 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF468
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ZABC1, zinc finger protein 217
• Host Species: Rabbit
• Molecular Weight of Antigen: 60 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Onchocerca volvulus: 100%; Canine: 100%; Rat: 100%; Florida lancelet: 100%; Trichoplax reptans: 100%; Bovine: 100%; Green puffer: 92%; Crab-eating macaque: 92%; Western clawed frog: 92%; Camponotus floridanus: 92%; Body louse: 92%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001008801
• Gene Symbols: ZNF468
• Immunogen: Synthetic peptide directed towards the middle region of human ZNF468The immunogen for this antibody is ZNF468. Peptide sequence FIHKALHTGEKPYECEECDKVFSRKSHLERHKRIHTGEKPYKCKVCDEAF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 90333
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.