Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF468 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF468 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF468 Polyclonal specifically detects ZNF468 in Human samples. It is validated for Western Blot.Specifications
ZNF468 | |
Polyclonal | |
Rabbit | |
NP_001008801 | |
90333 | |
Synthetic peptide directed towards the middle region of human ZNF468The immunogen for this antibody is ZNF468. Peptide sequence FIHKALHTGEKPYECEECDKVFSRKSHLERHKRIHTGEKPYKCKVCDEAF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ZABC1, zinc finger protein 217 | |
ZNF468 | |
IgG | |
60 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title