ZNF486 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179462

Catalog No. NBP179462

Description

ZNF486 Polyclonal specifically detects ZNF486 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF486
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KOX16MGC57283, Zfp612, zinc finger protein 23, zinc finger protein 23 (KOX 16), zinc finger protein 32, Zinc finger protein 359ZNF612kruppel-like zinc finger factor X31, Zinc finger protein 612, Zinc finger protein KOX16, ZNF359
• Host Species: Rabbit
• Molecular Weight of Antigen: 54 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Pig: 86%; Bovine: 86%; Dog: 85%; Horse: 85%; Rabbit: 85%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_443084
• Gene Symbols: ZNF486
• Immunogen: Synthetic peptide directed towards the C terminal of human ZNF486The immunogen for this antibody is ZNF486. Peptide sequence HRRTHTGEKPYKCEECGKAYTTSSNLTEHKTTHTGEKPYKCKECGKAFNW.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 90649
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.