ZNF499 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179966

Catalog No. NBP179966

Description

ZNF499 Polyclonal specifically detects ZNF499 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF499
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp547H249, FLJ14486, zinc finger and BTB domain containing 45, zinc finger and BTB domain-containing protein 45, zinc finger protein 499, ZNF499
• Host Species: Rabbit
• Molecular Weight of Antigen: 54 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Porcine: 79%; Guinea pig: 79%.
• Target Species: Human, Mouse, Rat, Canine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_116181
• Gene Symbols: ZBTB45
• Immunogen: Synthetic peptide directed towards the middle region of human ZNF499. Peptide sequence: CEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWHDEDGAVPEGC
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84878
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.