Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF499 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF499 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF499 Polyclonal specifically detects ZNF499 in Human samples. It is validated for Western Blot.Specifications
ZNF499 | |
Polyclonal | |
Rabbit | |
NP_116181 | |
84878 | |
Synthetic peptide directed towards the middle region of human ZNF499. Peptide sequence: CEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWHDEDGAVPEGC | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp547H249, FLJ14486, zinc finger and BTB domain containing 45, zinc finger and BTB domain-containing protein 45, zinc finger protein 499, ZNF499 | |
ZBTB45 | |
IgG | |
54 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title