Learn More
Description
Specifications
Specifications
| Antigen | ZNF507 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | BMZF-1ZNF411, Bone marrow zinc finger 1, DNA-binding protein, FLJ90391, zinc finger protein 253, Zinc finger protein 411BMZF1 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF507 (NP_055725). Peptide sequence SDGQVKTGISMSLLTVIEKLRERTDQNASDDDILKELQDNAQCQPNSDTS |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
