Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF561 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	ZNF561
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP18014820 View Documents View Product Certificates	Novus Biologicals NBP18014820UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP180148 View Documents View Product Certificates	Novus Biologicals NBP180148	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ZNF561 Polyclonal specifically detects ZNF561 in Human samples. It is validated for Western Blot.

Specifications

Antigen	ZNF561
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_689502
Gene ID (Entrez)	93134
Immunogen	Synthetic peptide directed towards the C terminal of human ZNF561. Peptide sequence KKPYQCKECGKAFTTSTSLIQHTRIHTGEKPYECVECGKTFITSSRRSKH.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	MGC45408, zinc finger protein 561
Gene Symbols	ZNF561
Isotype	IgG
Molecular Weight of Antigen	47 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ZNF561 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents