ZNF564 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180396

Catalog No. NBP180396

Description

ZNF564 Polyclonal specifically detects ZNF564 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF564
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ38281, MGC26914, zinc finger protein 564
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 163050
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_659413
• Gene Symbols: ZNF564
• Immunogen: Synthetic peptide directed towards the C terminal of human ZNF564. Peptide sequence GEKPYECKQCGKTFSYSSSFQRHERAHNGDKPYVKNVGKLSFITQPSNTC.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Zebrafish: 90%; Green puffer: 83%; Japanese pufferfish: 83%; Canine: 81%; Pig: 81%; Florida lancelet: 81%; Trichoplax reptans: 81%; Fruit fly: 81%; Bovine: 81%; Mouse: 81%; Rat: 81%; African malaria mosquito: 75%; Sumatran orangutan: 75%; Transparent sea squirt: 75%; Yellowfever mosquito: 75%; Mosquito: 75%; Red flour beetle: 75%; Cellular slime mold: 75%; Southern house mosquito: 75%; Human: 100%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG