Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF583 Antibody, Novus Biologicals™
SDP

Catalog No. NBP18016220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18016220 20 μL
NBP180162 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18016220 Supplier Novus Biologicals Supplier No. NBP18016220UL

Rabbit Polyclonal Antibody

ZNF583 Polyclonal specifically detects ZNF583 in Human samples. It is validated for Western Blot.

Specifications

Antigen ZNF583
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_689691
Gene Alias FLJ31030, zinc finger protein 583
Gene Symbols ZNF583
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human ZNF583. Peptide sequence TRGPCPDWEYVFKNSEFSSKQETYEESSKVVTVGARHLSYSLDYPSLRED.
Molecular Weight of Antigen 66 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 147949
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.