Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF583 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $487.50

Specifications

Antigen	ZNF583
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP18016220 View Documents View Product Certificates	Novus Biologicals NBP18016220UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP180162 View Documents View Product Certificates	Novus Biologicals NBP180162	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ZNF583 Polyclonal specifically detects ZNF583 in Human samples. It is validated for Western Blot.

Specifications

Antigen	ZNF583
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	FLJ31030, zinc finger protein 583
Gene Symbols	ZNF583
Isotype	IgG
Molecular Weight of Antigen	66 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	NP_689691
Gene ID (Entrez)	147949
Immunogen	Synthetic peptide directed towards the N terminal of human ZNF583. Peptide sequence TRGPCPDWEYVFKNSEFSSKQETYEESSKVVTVGARHLSYSLDYPSLRED.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ZNF583 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents