Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF607 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18012520UL
Description
ZNF607 Polyclonal specifically detects ZNF607 in Human samples. It is validated for Western Blot.Specifications
ZNF607 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_116078 | |
ZNF607 | |
Synthetic peptide directed towards the middle region of human ZNF607. Peptide sequence KECGKGFTCRYQLTMHQRIYSGEKHYECKENGEAFSSGHQLTAPHTFESV. | |
Affinity Purified | |
RUO | |
84775 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
FLJ14802, MGC13071, zinc finger protein 607 | |
Rabbit | |
81 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction