Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF607 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | ZNF607 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1802520
![]() |
Novus Biologicals
NBP18012520UL |
20 μL |
Each for $206.00
|
|
|||||
NBP180125
![]() |
Novus Biologicals
NBP180125 |
100 μL |
Each for $487.50
|
|
|||||
Description
ZNF607 Polyclonal specifically detects ZNF607 in Human samples. It is validated for Western Blot.Specifications
ZNF607 | |
Polyclonal | |
Rabbit | |
Human | |
FLJ14802, MGC13071, zinc finger protein 607 | |
ZNF607 | |
IgG | |
81 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_116078 | |
84775 | |
Synthetic peptide directed towards the middle region of human ZNF607. Peptide sequence KECGKGFTCRYQLTMHQRIYSGEKHYECKENGEAFSSGHQLTAPHTFESV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title