Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF664 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17946720UL
Description
ZNF664 Polyclonal specifically detects ZNF664 in Human samples. It is validated for Western Blot.Specifications
ZNF664 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_689650 | |
ZNF664 | |
Synthetic peptide directed towards the N terminal of human ZNF664The immunogen for this antibody is ZNF664. Peptide sequence FFHISELHIHWRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKC. | |
Affinity Purified | |
RUO | |
144348 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZp761B128, MGC126579, ZFOC1zinc finger Organ of Corti 1, Zinc finger protein 176ZNF176, zinc finger protein 664, Zinc finger protein from organ of Corti, ZNF196 | |
Rabbit | |
30 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction