ZNF664 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179467

Catalog No. NBP179467

Description

ZNF664 Polyclonal specifically detects ZNF664 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF664
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp761B128, MGC126579, ZFOC1zinc finger Organ of Corti 1, Zinc finger protein 176ZNF176, zinc finger protein 664, Zinc finger protein from organ of Corti, ZNF196
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_689650
• Gene Symbols: ZNF664
• Immunogen: Synthetic peptide directed towards the N terminal of human ZNF664The immunogen for this antibody is ZNF664. Peptide sequence FFHISELHIHWRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKC.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 144348
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig
• Isotype: IgG