Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF765 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | ZNF765 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19163020
![]() |
Novus Biologicals
NBP19163020UL |
20 μL |
Each for $206.00
|
|
|||||
NBP191630
![]() |
Novus Biologicals
NBP191630 |
100 μL |
Each for $487.50
|
|
|||||
Description
ZNF765 Polyclonal specifically detects ZNF765 in Human samples. It is validated for Western Blot.Specifications
ZNF765 | |
Polyclonal | |
Rabbit | |
NP_001035275 | |
91661 | |
The immunogen for this antibody is ZNF765. Peptide sequence CHRRLHTGEKPYKCEECDKAFHFKSKLQIHRRIHTGEKPYKCNECGKTFS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
zinc finger protein 765 | |
ZNF765 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title