ZNF81 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179990

Catalog No. NBP179990

Description

ZNF81 Polyclonal specifically detects ZNF81 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZNF81
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: ZNF81
• Immunogen: Synthetic peptide directed towards the middle region of human ZNF81. Peptide sequence QRIHTGEKPYICAECGKAFTDRSNFNKHQTIHTGDKPYKCSDCGKGFTQK.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 347344
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Alias: dJ54B20.6, FLJ44367, HFZ20X-linked 45, zinc finger protein 81, zinc finger protein 81 (HFZ20)
• Host Species: Rabbit
• Molecular Weight of Antigen: 76 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG