ZNFN1A4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310512100UL

Catalog No. NB125925

Description

ZNFN1A4 Polyclonal specifically detects ZNFN1A4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZNFN1A4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Alias: EOS, IKAROS family zinc finger 4 (Eos), Ikaros family zinc finger protein 4, KIAA1782Eos, zinc finger protein, subfamily 1A, 4 (Eos), zinc finger transcription factor Eos, ZNFN1A4zinc finger protein Eos
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human ZNFN1A4 (NP_071910). Peptide sequence GSHRQGKDNLERDPSGGCVPDFLPQAQDSNHFIMESLFCESSGDSSLEKE
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64375
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.