Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNFN1A4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | ZNFN1A4 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ZNFN1A4 Polyclonal specifically detects ZNFN1A4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ZNFN1A4 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| EOS, IKAROS family zinc finger 4 (Eos), Ikaros family zinc finger protein 4, KIAA1782Eos, zinc finger protein, subfamily 1A, 4 (Eos), zinc finger transcription factor Eos, ZNFN1A4zinc finger protein Eos | |
| The immunogen is a synthetic peptide directed towards the n terminal region of human ZNFN1A4 (NP_071910). Peptide sequence GSHRQGKDNLERDPSGGCVPDFLPQAQDSNHFIMESLFCESSGDSSLEKE | |
| Affinity purified |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 64375 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title