ZNHIT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179374

Catalog No. NBP179374

Description

ZNHIT1 Polyclonal specifically detects ZNHIT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNHIT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CG1I, CGBP1, Cyclin-G1-binding protein 1, H_DJ0747G18.14, p18 Hamlet, p18Hamlet, putative cyclin G1 interacting protein, zinc finger HIT domain-containing protein 1, Zinc finger protein subfamily 4A member 1, zinc finger protein, subfamily 4A (HIT domain containing), member 1, zinc finger, HIT domain containing 1, zinc finger, HIT type 1, zinc finger, HIT-type containing 1, ZNFN4A1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 92%; Mouse: 85%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_006340
• Gene Symbols: ZNHIT1
• Immunogen: Synthetic peptide directed towards the N terminal of human ZNHIT1The immunogen for this antibody is ZNHIT1. Peptide sequence MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQ.
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 10467
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.