Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNHIT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNHIT1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNHIT1 Polyclonal specifically detects ZNHIT1 in Human samples. It is validated for Western Blot.Specifications
ZNHIT1 | |
Polyclonal | |
Rabbit | |
NP_006340 | |
10467 | |
Synthetic peptide directed towards the N terminal of human ZNHIT1The immunogen for this antibody is ZNHIT1. Peptide sequence MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CG1I, CGBP1, Cyclin-G1-binding protein 1, H_DJ0747G18.14, p18 Hamlet, p18Hamlet, putative cyclin G1 interacting protein, zinc finger HIT domain-containing protein 1, Zinc finger protein subfamily 4A member 1, zinc finger protein, subfamily 4A (HIT domain containing), member 1, zinc finger, HIT domain containing 1, zinc finger, HIT type 1, zinc finger, HIT-type containing 1, ZNFN4A1 | |
ZNHIT1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title