ZNHIT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP185673

Catalog No. NBP185673

Description

ZNHIT1 Polyclonal specifically detects ZNHIT1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZNHIT1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
• Gene Alias: CG1I, CGBP1, Cyclin-G1-binding protein 1, H_DJ0747G18.14, p18 Hamlet, p18Hamlet, putative cyclin G1 interacting protein, zinc finger HIT domain-containing protein 1, Zinc finger protein subfamily 4A member 1, zinc finger protein, subfamily 4A (HIT domain containing), member 1, zinc finger, HIT domain containing 1, zinc finger, HIT type 1, zinc finger, HIT-type containing 1, ZNFN4A1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ZNHIT1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKK
• Quantity: 0.1 mL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 10467
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only