Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNHIT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23409625UL
Description
ZNHIT2 Polyclonal specifically detects ZNHIT2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ZNHIT2 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q9UHR6 | |
ZNHIT2 | |
This antibody was developed against a recombinant protein corresponding to amino acids: CTPVVPTRIPAIVSLSRGPVSPLVRFQLPNVLFAYAHTLALYHGGDDALLSDFCATLLGVSGALGAQQVFASAEEAL | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
C11orf5zinc finger HIT domain-containing protein 2, chromosome 11 open reading frame 5, FONMGC120286, MGC120285, Protein FON, zinc finger, HIT domain containing 2, zinc finger, HIT type 2, zinc finger, HIT-type containing 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
741 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction