ZNRF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP184196

Catalog No. NBP184196

Description

ZNRF1 Polyclonal specifically detects ZNRF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZNRF1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: DKFZp434E229, EC 6.3.2, EC 6.3.2.-, FLJ14846, MGC15430, nerve injury gene 283, Nerve injury-induced gene 283 protein, nin283, NIN283E3 ubiquitin-protein ligase ZNRF1, zinc and ring finger 1, zinc and ring finger protein 1, Zinc/RING finger protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ZNRF1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLPIAPRWFSSHSGFKCPICSKSVASDEMEMHFI
• Quantity: 0.1 mL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 84937
• Target Species: Human
• Isotype: IgG

For Research Use Only