ZnT-8/SLC30A8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159424

Catalog No. NBP159424

Description

ZnT-8/SLC30A8 Polyclonal specifically detects ZnT-8/SLC30A8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZnT-8/SLC30A8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: solute carrier family 30 (zinc transporter), member 8, Solute carrier family 30 member 8, zinc transporter 8, zinc transporter ZnT-8, ZNT8ZnT-8
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 169026
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IWU4
• Gene Symbols: SLC30A8
• Immunogen: Synthetic peptides corresponding to SLC30A8(solute carrier family 30 (zinc transporter), member 8) The peptide sequence was selected from the middle region of SLC30A8. Peptide sequence LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Pig: 100%; Canine: 92%; Rabbit: 92%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only