ZRANB1/Trabid Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP186918

Catalog No. NBP186918

Description

ZRANB1/Trabid Polyclonal specifically detects ZRANB1/Trabid in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZRANB1/Trabid
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: HRPE773, jacalin-like lectin domain containing 2, JCLN2, pancreatic adenocarcinoma upregulated factor, PAUF, PRO1567, zymogen granule protein 16 homolog B, zymogen granule protein 16 homolog B (rat)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ZRANB1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SSGNSQRRSPPATKRDSEVKMDFQRIELAGAVGSKEELEVDFKKLKQIKNRMKKTDWLFLNACVGVVEGDLAAIEAYKSSGGDIARQLT
• Quantity: 0.1 mL
• Research Discipline: Cancer, DNA Repair, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 54764
• Target Species: Human
• Isotype: IgG

For Research Use Only