Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZRANB1/Trabid Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309380100UL
Description
ZRANB1/Trabid Polyclonal specifically detects ZRANB1/Trabid in Human samples. It is validated for Western Blot.Specifications
ZRANB1/Trabid | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
HRPE773, jacalin-like lectin domain containing 2, JCLN2, pancreatic adenocarcinoma upregulated factor, PAUF, PRO1567, zymogen granule protein 16 homolog B, zymogen granule protein 16 homolog B (rat) | |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZRANB1/Trabid (NP_060050). Peptide sequence GAGANLNTDDDVTITFLPLVDSERKLLHVHFLSAQELGNEEQQEKLLREW | |
100 μg | |
Cancer, DNA Repair, DNA replication Transcription Translation and Splicing | |
54764 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction