Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

ZRANB1/Trabid Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody


Antigen ZRANB1/Trabid
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents Promotion Details
Novus Biologicals
25 μg
Each for $106.19
View Documents Promotion Details
Novus Biologicals
100 μg
Each for $352.89


ZRANB1/Trabid Polyclonal specifically detects ZRANB1/Trabid in Human samples. It is validated for Western Blot.


Western Blot
HRPE773, jacalin-like lectin domain containing 2, JCLN2, pancreatic adenocarcinoma upregulated factor, PAUF, PRO1567, zymogen granule protein 16 homolog B, zymogen granule protein 16 homolog B (rat)
The immunogen is a synthetic peptide directed towards the C terminal region of human ZRANB1/Trabid (NP_060050). Peptide sequence GAGANLNTDDDVTITFLPLVDSERKLLHVHFLSAQELGNEEQQEKLLREW
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Cancer, DNA Repair, DNA replication Transcription Translation and Splicing
PBS buffer, 2% sucrose
Affinity purified
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit