Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZUFSP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$182.00 - $487.50
Specifications
| Antigen | ZUFSP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18039720
|
Novus Biologicals
NBP18039720UL |
20 μL |
Each for $182.00
|
|
|||||
|
NBP180397
|
Novus Biologicals
NBP180397 |
100 μL |
Each for $487.50
|
|
|||||
Description
ZUFSP Polyclonal specifically detects ZUFSP in Human samples. It is validated for Western Blot.Specifications
| ZUFSP | |
| Polyclonal | |
| Rabbit | |
| NP_659499 | |
| 221302 | |
| Synthetic peptide directed towards the C terminal of human C6orf113. Peptide sequence LCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C6orf113, chromosome 6 open reading frame 113, dJ412I7.3, zinc finger with UFM1-specific peptidase domain, zinc finger with UFM1-specific peptidase domain protein | |
| ZUFSP | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title