Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZUFSP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18039720UL
Description
ZUFSP Polyclonal specifically detects ZUFSP in Human samples. It is validated for Western Blot.Specifications
ZUFSP | |
Polyclonal | |
Western Blot 1:1000 | |
NP_659499 | |
ZUFSP | |
Synthetic peptide directed towards the C terminal of human C6orf113. Peptide sequence LCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEG. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
C6orf113, chromosome 6 open reading frame 113, dJ412I7.3, zinc finger with UFM1-specific peptidase domain, zinc finger with UFM1-specific peptidase domain protein | |
Rabbit | |
Affinity Purified | |
RUO | |
221302 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction