Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZXDC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17936820UL
Description
ZXDC Polyclonal specifically detects ZXDC in Human, Mouse samples. It is validated for Western Blot.Specifications
ZXDC | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001035743 | |
ZXDC | |
Synthetic peptide directed towards the middle region of human ZXDCThe immunogen for this antibody is ZXDC. Peptide sequence NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG. | |
20 μL | |
Primary | |
Human, Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
dJ337O18.5, SWIM domain containing 1, zinc finger, SWIM-type containing 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
79364 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction