Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZXDC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	ZXDC
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP17936820 View Documents View Product Certificates	Novus Biologicals NBP17936820UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP179368 View Documents View Product Certificates	Novus Biologicals NBP179368	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ZXDC Polyclonal specifically detects ZXDC in Human samples. It is validated for Western Blot.

Specifications

Antigen	ZXDC
Classification	Polyclonal
Host Species	Rabbit
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	dJ337O18.5, SWIM domain containing 1, zinc finger, SWIM-type containing 1
Gene Symbols	ZXDC
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	NP_001035743
Gene ID (Entrez)	79364
Immunogen	Synthetic peptide directed towards the middle region of human ZXDCThe immunogen for this antibody is ZXDC. Peptide sequence NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ZXDC Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents