Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Conjugate
- (62)
Recombinant
- (61)
For Use With (Application)
- (1)
- (9)
- (2)
- (19)
- (32)
- (8)
- (9)
- (9)
- (13)
- (3)
- (8)
Form
- (20)
- (25)
Species
- (1)
- (24)
- (4)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
1
–
15
of
167
results
Promotions Available
Invitrogen™ Human NUP50 (aa 5-45) Control Fragment Recombinant Protein
Invitrogen™ Human NUP50 (aa 5-45) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | NAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKR |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human NUP50 (aa 5-45) Control Fragment |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Human IL-11 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
| Purity or Quality Grade | 97%, by SDS-PAGE under reducing conditions and visualized by silver stain. |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | Adipogenesis inhibitory factor, AGIF, AGIFoprelvekin, IL11, IL-11Oprelvekin, interleukin 11, interleukin-11, Oprelvekin |
| Molecular Weight (g/mol) | 19 kDa |
| Gene ID (Entrez) | 3589 |
| Source | Spodoptera frugiperda,Sf 21 (baculovirus)-derived human IL-11 protein Pro22-Leu199 |
| Recombinant | Recombinant |
| Name | IL-11 |
Promotions Available
Invitrogen™ Human SLC45A1 (aa 448-523) Control Fragment Recombinant Protein
Invitrogen™ Human SLC45A1 (aa 448-523) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | SLC45A1 |
| Gene Symbol | SLC45A1 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | QDRGLLEGREGALTSGCDGDILRVGSLDTSKPRSSGILKRPQTLAIPDAAGGGGPETSRRRNVTFSQQVANILLNG |
| Concentration | 3.90 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human SLC45A1 (aa 448-523) Control Fragment |
| Accession Number | Q9Y2W3 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | deleted in neuroblastoma 5 protein; DNB5; DNb-5; H+/sugar symporter; PAST-A; Proton-associated sugar transporter A; SLC45A1; Solute carrier family 45 member 1; solute carrier family 45, member 1 |
| Product Type | Protein |
| Gene ID (Entrez) | 50651 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
Novus Biologicals™ NSBP1 Recombinant Protein Antigen
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
Promotions Available
Invitrogen™ Human PRSS45 (aa 33-91) Control Fragment Recombinant Protein
Invitrogen™ Human PRSS45 (aa 33-91) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | AHCIQGTKEYSVVLGTSKLQPMNFSRALWVPVRDIIMHPKYWGRAFIMGDVALVHLQTP |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human PRSS45 (aa 33-91) Control Fragment |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Human N-Acetylglucosaminyltransferase1/MGAT1
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity
Promotions Available
Invitrogen™ Human CT45A (aa 5-54) Control Fragment Recombinant Protein
Invitrogen™ Human CT45A (aa 5-54) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | TEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSK |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human CT45A (aa 5-54) Control Fragment |
| Recombinant | Recombinant |
Promotions Available
Invitrogen™ Human CT45A (aa 152-189) Control Fragment Recombinant Protein
Invitrogen™ Human CT45A (aa 152-189) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | QGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human CT45A (aa 152-189) Control Fragment |
| Recombinant | Recombinant |
Promotions Available
Invitrogen™ Human CT45A (aa 88-126) Control Fragment Recombinant Protein
Invitrogen™ Human CT45A (aa 88-126) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | PGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADI |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human CT45A (aa 88-126) Control Fragment |
| Recombinant | Recombinant |
Promotions Available
Invitrogen™ Human CT45A (aa 56-81) Control Fragment Recombinant Protein
Invitrogen™ Human CT45A (aa 56-81) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | KKLMTGHAIPPSQLDSQIDDFTGFSK |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human CT45A (aa 56-81) Control Fragment |
| Recombinant | Recombinant |
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Purity or Quality Grade | >96% as determined by SDS-PAGE. |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Common Name | VSIG4 |
| Molecular Weight (g/mol) | 45 kDa |
| Gene Symbol | VSIG4 |
| Endotoxin Concentration | <1.0 EU/μg |
| Sequence | Human VSIG4, amino acids Met1-Pro283 (Accession # Q9Y279-1) with a C-terminal His-tag |
| Concentration | 0.25 mg/mL |
| Expression System | HEK293 cells |
| For Use With (Application) | Control,Neutralization |
| Name | Human VSIG4 His-tag |
| Accession Number | Q9Y279 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | A530061A11; BC025105; complement receptor of the immunoglobulin superfamily; CRIg; Ig superfamily protein; MGC137243 protein; protein Z39Ig; UNQ317/PRO362; V-set and immunoglobulin domain containing 4; V-set and immunoglobulin domain-containing protein 4; VSIG4; Z39IG |
| Format | Lyophilized |
| Product Type | Protein |
| Gene ID (Entrez) | 11326 |
| Formulation | PBS with 5% mannitol, 5% trehalose, 0.01% Tween 80 and no preservative; pH 7.4 |
| Protein Tag | His-tag |
| Recombinant | Recombinant |
Promotions Available
Invitrogen™ Human HMGN5 (aa 23-124) Control Fragment Recombinant Protein
Invitrogen™ Human HMGN5 (aa 23-124) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVK |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human HMGN5 (aa 23-124) Control Fragment |
| Recombinant | Recombinant |
Promotions Available
Invitrogen™ Human HMGN5 (aa 139-209) Control Fragment Recombinant Protein
Invitrogen™ Human HMGN5 (aa 139-209) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | EEKGEAGKEDKDEKGEEDGKEDKNGNEKGEDAKEKEDGKKGEDGKGNGEDGKEKGEDEKEEEDRKETGDGK |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human HMGN5 (aa 139-209) Control Fragment |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Rat Serpin A12 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.