accessibility menu, dialog, popup

UserName
Viewing profile as user:

Recombinant Proteins

Recombinant Proteins

-
Conjugate 
  • (2)
  • (1,359)
Recombinant 
  • (1,337)
For Use With (Application) 
  • (2)
  • (1)
  • (13)
  • (618)
  • (644)
  • (61)
  • (58)
  • (123)
  • (1)
  • (5)
  • (3)
  • (421)
  • (31)
  • (65)
Form 
  • (1,051)
  • (131)
  • (5)
Species 
  • (2)
  • (11)
  • (1)
  • (1,056)
  • (11)
Keyword Search: serine Clear all selections

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

serine

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

special offers

  • (3)
  • (3)

brands

  • (36)
  • (1)
  • (4)
  • (8)
  • (8)
  • (1)
  • (55)
  • (2)
  • (4)
  • (6)
  • (3)
  • (1)
  • (9)
  • (6)
  • (1)
  • (13)
  • (1)
  • (6)
  • (26)
  • (5)
  • (7)
  • (27)
  • (1,020)
  • (3)
  • (1)
  • (2)
  • (1)
  • (34)
  • (2)
  • (106)
  • (2)
  • (149)
  • (1)
  • (14)
  • (1)
  • (2)
  • (31)
  • (2)
  • (1)

special interests

  • (1)
  • (70)
  • (116)

Conjugate

  • (2)
  • (1,359)

Recombinant

  • (1,337)

For Use With (Application)

  • (2)
  • (1)
  • (13)
  • (618)
  • (644)
  • (61)
  • (58)
  • (123)
  • (1)
  • (5)
  • (3)
  • (421)
  • (31)
  • (65)

Form

  • (1,051)
  • (131)
  • (5)

Species

  • (2)
  • (11)
  • (1)
  • (1,056)
  • (11)
1 – 15 of 1,306 results
1

Invitrogen™ Human Serine racemase (aa 173-272) Control Fragment Recombinant Protein

Recombinant Protein

ENCOMPASS_PREFERRED
Regulatory Status RUO
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Conjugate Unconjugated
Form Liquid
Formulation 1 M urea, PBS with no preservative; pH 7.4
Sequence QVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQ
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay,Control
Name Human Serine racemase (aa 173-272) Control Fragment
Recombinant Recombinant
2

Novus Biologicals™ Recombinant Human Serine racemase His Protein
SDP

Highly purified. Generating reliable and reproducible results.

3

Invitrogen™ Human PLK2, GST Tag Recombinant Protein

Recombinant Protein

ENCOMPASS_PREFERRED
Shipping Condition Dry Ice
Content And Storage -80°C, Avoid Freeze/Thaw Cycles
Conjugate Unconjugated
Form Liquid
Common Name PLK2
Molecular Weight (g/mol) 105.7 kDa
KinaseFamily PLK Kinase Family
Sequence Full length
Concentration See Label
Expression System Baculovirus
For Use With (Application) Kinase Assay
Name Human PLK2, GST Tag
Accession Number Q9NYY3
Gene Alias h PLK-2; hPlk2; hSNK; Plk2; PLK-2; polo like kinase 2; polo-like kinase 1; polo-like kinase 2; Serine/threonine-protein kinase PLK2; serine/threonine-protein kinase SNK; Serum-inducible kinase; SNK
Gene ID (Entrez) 10769
Formulation 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag GST-tag
Species Human
Recombinant Recombinant
4

Invitrogen™ Human NIM1, GST Tag Recombinant Protein

Recombinant Protein

EDGE ENCOMPASS_PREFERRED
Shipping Condition Dry Ice
Content And Storage -80°C, Avoid Freeze/Thaw Cycles
Conjugate Unconjugated
Form Liquid
Common Name NIM1
Molecular Weight (g/mol) 75.9 kDa
KinaseFamily CAMK Unique Kinase Family
Sequence Full length
Concentration See Label
Expression System Insect cells
For Use With (Application) Kinase Assay
Name Human NIM1, GST Tag
Accession Number Q8IY84
Gene Alias E130304F04Rik; Nim1; NIM1 serine/threonine protein kinase; NIM1 serine/threonine-protein kinase; NIM1K; Serine/threonine-protein kinase NIM1
Protein Form Full Length, Recombinant, Active
Gene ID (Entrez) 167359
Formulation 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Protein Tag GST-tag
Species Human
Recombinant Recombinant
5

Invitrogen™ Human TLK1, GST Tag Recombinant Protein

Recombinant Protein

EDGE ENCOMPASS_PREFERRED
Content And Storage -80°C, Avoid Freeze/Thaw Cycles
Conjugate Unconjugated
Form Liquid
Common Name TLK1
Molecular Weight (g/mol) 113 kDa
Concentration See Label
For Use With (Application) Kinase Assay
Name Human TLK1, GST Tag
Accession Number Q9UKI8
Gene Alias 4930545J15Rik; E(Sp1) homolog; Enhancer of split groucho-like protein 1; ESG; ESG1; GRG1; KIAA0137; PKU beta; PKU-beta; serine threonine protein kinase; serine/threonine-protein kinase tousled-like 1; SNAK; SNARE protein kinase SNAK; TLE1; TLK1; TLK-1; TLK1B; tousled like kinase 1; tousled-like kinase 1; transducin like enhancer of split 1; transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila); transducin-like enhancer protein 1
Gene ID (Entrez) 9874
Formulation 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Protein Tag GST-tag
Species Human
Recombinant Recombinant
6

Invitrogen™ Human DYRK1A, GST Tag Recombinant Protein

Recombinant Protein

EDGE ENCOMPASS_PREFERRED
Content And Storage -80°C, Avoid Freeze/Thaw Cycles
Purity or Quality Grade 85% by SDS-PAGE
Conjugate Unconjugated
Form Liquid
Common Name DYRK1A
Molecular Weight (g/mol) 113 kDa
Sequence Full length
Concentration See Label
Expression System Insect cells
For Use With (Application) Kinase Assay
Name Human DYRK1A, GST Tag
Accession Number Q13627
Gene Alias 2310043O08Rik; D16Ertd272e; D16Ertd493e; dual specificity tyrosine phosphorylation regulated kinase 1 A; dual specificity tyrosine-(Y)-phosphorylation regulated kinase 1 A; dual specificity tyrosine-phosphorylation-regulated kinase 1 A; Dual specificity YAK1-related kinase; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1 A; Dyrk; DYRK1; Dyrk1a; ENSMUSG00000074897; Gm10783; hMNB; HP86; mmb; MNB; mnb protein kinase homolog hp86; MNB/DYRK protein kinase; MNBH; MP86; MRD7; OTTHUMP00000109090; Protein kinase minibrain homolog; PSK47; RP86; serine/threonine kinase MNB; serine/threonine-specific protein kinase
Gene ID (Entrez) 1859
Formulation 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag GST-tag
Species Human
Recombinant Recombinant
7

Invitrogen™ Human VRK2, GST Tag Recombinant Protein

Recombinant Protein

EDGE ENCOMPASS_PREFERRED
Shipping Condition Dry Ice
Content And Storage -80°C, Avoid Freeze/Thaw Cycles
Conjugate Unconjugated
Form Liquid
Common Name VRK2
Molecular Weight (g/mol) 68.8 kDa
KinaseFamily CK1 Kinase Family
Concentration See Label
Expression System Insect cells
For Use With (Application) Kinase Assay
Name Human VRK2, GST Tag
Accession Number Q86Y07
Gene Alias 2810003O05Rik; AI447698; Serine/threonine-protein kinase VRK2; vaccinia related kinase 2; vaccinia virus B1R-related kinase 2; vaccinia virus BIR kinase related kinase 2; vaccinia-related kinase 2; Vrk2
Protein Form Recombinant, Active, Catalytic
Protein Length 1-375
Gene ID (Entrez) 7444
Formulation 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Protein Tag GST-tag
Species Human
Recombinant Recombinant
8

Invitrogen™ Human PIM2, GST Tag Recombinant Protein

Recombinant Protein

EDGE ENCOMPASS_PREFERRED
Content And Storage -80°C, Avoid Freeze/Thaw Cycles
Conjugate Unconjugated
Form Liquid
Common Name PIM2
Molecular Weight (g/mol) 63.7 kDa
KinaseFamily PIM Kinase Family
Sequence Full length
Concentration See Label
Expression System Insect cells
For Use With (Application) Kinase Assay
Name Human PIM2, GST Tag
Accession Number Q9P1W9
Regulatory Status RUO - research use only
Gene Alias DXCch3; PIM2; Pim-2; pim-2 oncogene; Pim-2 proto-oncogene, serine/threonine kinase; pim-2 h; proto-oncogene Pim-2 (serine threonine kinase); proviral integration site 2; serine/threonine protein kinase pim-2; serine/threonine-protein kinase pim-2
Gene ID (Entrez) 11040
Formulation 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag GST-tag
Species Human
Recombinant Recombinant
9

Invitrogen™ Human MKNK1 (MNK1), GST Tag Recombinant Protein

Recombinant Protein

EDGE ENCOMPASS_PREFERRED
Protein Family Kinases & Inhibitors
Conjugate Unconjugated
Form Liquid
Common Name MNK1
Molecular Weight (g/mol) 66.6 kDa
KinaseFamily MAPKAPK Kinase Family
Kinase Group Ser⁄Thr Kinases: CAMK Group
Expression System Insect cells
For Use With (Application) Kinase Assay
Name Human MKNK1 (MNK1), GST Tag
Gene Alias 2410048M24Rik; MAP kinase interacting serine/threonine kinase 1; MAP kinase signal-integrating kinase 1; MAP kinase-interacting serine/threonine kinase 1; MAP kinase-interacting serine/threonine-protein kinase 1; MAPK signal-integrating kinase 1; MKNK1; Mnk1; OTTHUMP00000009675; OTTHUMP00000009676
Protein Form Recombinant, Full Length
Tag Position N-Terminal
Formulation 50 mM tris with no preservative
Research Category Signal Transduction
Target Gene MKNK1
Species Human
Recombinant Recombinant
Shipping Condition Dry Ice
Content And Storage -80°C, Avoid Freeze/Thaw Cycles
Quantity 10 μg
Sequence Full length
Concentration See Label
Protein Subtype Serine/Threonine Kinases
Accession Number Q9BUB5
Gene ID (Entrez) 8569
Protein Tag GST-tag
10

R&D Systems™ Recombinant Human HGF Activator Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity

11

R&D Systems™ Human Plasminogen Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity

12

R&D Systems™ Recombinant Human Complement Component C1s Protein
GSA_VA

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity

13

Invitrogen™ Human TLK2, GST Tag Recombinant Protein

Recombinant Protein

EDGE ENCOMPASS_PREFERRED
Content And Storage -80°C, Avoid Freeze/Thaw Cycles
Conjugate Unconjugated
Form Liquid
Common Name TLK2
Molecular Weight (g/mol) 68.2 kDa
Concentration See Label
Expression System Baculovirus
For Use With (Application) Kinase Assay
Name Human TLK2, GST Tag
Accession Number Q86UE8
Gene Alias 4933403M19Rik; HsHPK; PKUalpha; PKU-alpha; protein kinase U-alpha; serine/threonine-protein kinase tousled-like 2; Tlk; Tlk2; tousled like kinase 2; tousled-like kinase 2; tousled-like kinase 2 (Arabidopsis)
Protein Length 388-end
Gene ID (Entrez) 11011
Formulation 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Protein Tag GST-tag
Species Human
Recombinant Recombinant
14

Invitrogen™ Human PASK, GST Tag Recombinant Protein

Recombinant Protein

EDGE ENCOMPASS_PREFERRED
Regulatory Status For research use only. Not for use in diagnostic procedures
Conjugate Unconjugated
Form Liquid
Molecular Weight (g/mol) 77.2 kDa
Formulation 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Concentration See Label
For Use With (Application) Kinase Assay
Name Human PASK, GST Tag
Recombinant Recombinant
15

Invitrogen™ Human CDK14 (PFTK1)/cyclin Y, GST Tag Recombinant Protein

Recombinant Protein

EDGE ENCOMPASS_PREFERRED
Content And Storage -80°C, Avoid Freeze/Thaw Cycles
Conjugate Unconjugated
Form Liquid
Common Name PFTK1
Molecular Weight (g/mol) 77.0-65.5 kDa
Sequence CDK14: 1-469; Cyclin Y: 2-341
Concentration See Label
Expression System Baculovirus
For Use With (Application) Kinase Assay
Name Human CDK14 (PFTK1)/cyclin Y, GST Tag
Accession Number O94921
Gene Alias Cdk14; Cell division protein kinase 14; cyclin dependent kinase 14; cyclin-dependent kinase 14; hPFTAIRE1; Kiaa0834; mKIAA0834; PFTAIRE protein kinase 1; PFTAIRE1; Pftk1; Serine/threonine-protein kinase PFTAIRE-1
Gene ID (Entrez) 5218
Formulation 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Protein Tag GST-tag
Species Human
Recombinant Recombinant