accessibility menu, dialog, popup

UserName
Viewing profile as user:

Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Conjugate 
  • (2)
  • (1,380)
Recombinant 
  • (1,357)
For Use With (Application) 
  • (2)
  • (8)
  • (45)
  • (617)
  • (653)
  • (39)
  • (7)
  • (60)
  • (87)
  • (3)
  • (431)
  • (2)
  • (31)
  • (48)
  • (6)
Form 
  • (1,058)
  • (123)
  • (5)
Species 
  • (2)
  • (10)
  • (1)
  • (1,083)
  • (13)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (72)

brands

  • (1)
  • (34)
  • (1)
  • (288)
  • (8)
  • (8)
  • (5)
  • (1)
  • (92)
  • (2)
  • (4)
  • (6)
  • (3)
  • (1)
  • (8)
  • (1)
  • (6)
  • (1)
  • (12)
  • (1)
  • (6)
  • (25)
  • (12)
  • (10)
  • (7)
  • (28)
  • (1,029)
  • (37)
  • (1)
  • (34)
  • (3)
  • (104)
  • (20)
  • (2)
  • (150)
  • (3)
  • (14)
  • (1)
  • (1)
  • (2)
  • (8)
  • (2)
  • (1)

special interests

  • (1)
  • (26)
  • (5)
  • (118)

Conjugate

  • (2)
  • (1,380)

Recombinant

  • (1,357)

For Use With (Application)

  • (2)
  • (8)
  • (45)
  • (617)
  • (653)
  • (39)
  • (7)
  • (60)
  • (87)
  • (3)
  • (431)
  • (2)
  • (31)
  • (48)
  • (6)

Form

  • (1,058)
  • (123)
  • (5)

Species

  • (2)
  • (10)
  • (1)
  • (1,083)
  • (13)
Search Within Results
Keyword Search:
1 – 15 of 1,726 results
1

Novus Biologicals™ Recombinant Human Serine racemase His Protein
SDP

Highly purified. Generating reliable and reproducible results.

2

Invitrogen™ Human Serine racemase (aa 173-272) Control Fragment Recombinant Protein

Recombinant Protein

ENCOMPASS_PREFERRED
Regulatory Status RUO
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Conjugate Unconjugated
Form Liquid
Formulation 1 M urea, PBS with no preservative; pH 7.4
Sequence QVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQ
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay,Control
Name Human Serine racemase (aa 173-272) Control Fragment
Recombinant Recombinant
4

R&D Systems™ Recombinant Human HGF Activator Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity

5

R&D Systems™ Human Plasminogen Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity

6

ProSci SHMT1 Recombinant Protein

Recombinant Protein

Molecular Weight (g/mol) 53.9 kDa
Species Human
Source Human Cells
7

Invitrogen™ Human TLK2, GST Tag Recombinant Protein

Recombinant Protein

EDGE ENCOMPASS_PREFERRED
Content And Storage -80°C, Avoid Freeze/Thaw Cycles
Conjugate Unconjugated
Form Liquid
Common Name TLK2
Molecular Weight (g/mol) 68.2 kDa
Concentration See Label
Expression System Baculovirus
For Use With (Application) Kinase Assay
Name Human TLK2, GST Tag
Accession Number Q86UE8
Gene Alias 4933403M19Rik; HsHPK; PKUalpha; PKU-alpha; protein kinase U-alpha; serine/threonine-protein kinase tousled-like 2; Tlk; Tlk2; tousled like kinase 2; tousled-like kinase 2; tousled-like kinase 2 (Arabidopsis)
Protein Length 388-end
Gene ID (Entrez) 11011
Formulation 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Protein Tag GST-tag
Species Human
Recombinant Recombinant
8

Invitrogen™ Human ACVR2B, GST Tag Recombinant Protein

Recombinant Protein

EDGE ENCOMPASS_PREFERRED
Content And Storage -80°C, Avoid Freeze/Thaw Cycles
Conjugate Unconjugated
Form Liquid
Common Name ACVR2B
Molecular Weight (g/mol) 62 kDa
KinaseFamily STKR Kinase Family
Concentration See Label
Expression System Baculovirus
For Use With (Application) Kinase Assay
Name Human ACVR2B, GST Tag
Accession Number Q13705
Gene Alias activin A receptor type 2 B; activin A receptor type IIB; activin A receptor, type IIB; activin receptor IIB; activin receptor type IIB; Activin receptor type-2 B; Activine receptor 2 b (transmembrane serine kinase); ActRIIB; ACTR-IIB; ActRIIB type II activin receptor B; ACVR2B; HT x 4; MGC116908
Protein Length 185-488
Gene ID (Entrez) 93
Formulation 50 mM tris with no preservative
Protein Tag GST-tag
Species Human
Recombinant Recombinant
9

ProSci Tryptase epsilon Recombinant Protein

Recombinant Protein

Molecular Weight (g/mol) 31.56 kDa
Species Human
Source Human Cells
10

Invitrogen™ Human CDK4/cyclin D3, GST Tag Recombinant Protein

Recombinant Protein

EDGE ENCOMPASS_PREFERRED
Conjugate Unconjugated
Form Liquid
pH Range 7.5
Common Name CDK4/Cyclin D3
Molecular Weight (g/mol) 60.0-58.8 kDa
KinaseFamily CDKs and CHKs
Expression System Insect cells
For Use With (Application) Kinase Assay
Name Human CDK4/cyclin D3, GST Tag
Purification Method Purified
Gene Alias Cdk4; Cell division protein kinase 4; CMM3; Crk3; cyclin dependent kinase 4; cyclin-dependent kinase 4; MGC14458; PSK-J3; serine/threonine kinase; Unknown (protein for MGC:133903)
Protein Form Full Length, Recombinant, Active
Formulation 50mM tris HCl with 0.1mM PMSF, 150mM NaCl, 0.1mM EDTA, 0.25mM DTT, 25% glycerol, 10mM glutathione and no preservative; pH 7.5
Species Human
Recombinant Recombinant
Shipping Condition Dry Ice
Content And Storage -80°C, Avoid Freeze/Thaw Cycles
Gene Symbol CCND3, CDK4
Sequence CDK4: 1-303, Cyclin D3: 1-292
Storage Requirements -80°C, Avoid Freeze/Thaw Cycles
Concentration See Label
Accession Number P11802, P30281
Regulatory Status RUO
Product Type Protein
Gene ID (Entrez) 1019, 896
Protein Tag GST-tag
11

R&D Systems™ Recombinant Mouse Marapsin/Pancreasin Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity

12

R&D Systems™ Recombinant Human Marapsin/Pancreasin Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

13

R&D Systems™ Recombinant Human SLPI Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Inhibition Activity

14

Invitrogen™ Human PLK2, GST Tag Recombinant Protein

Recombinant Protein

EDGE ENCOMPASS_PREFERRED
Shipping Condition Dry Ice
Content And Storage -80°C, Avoid Freeze/Thaw Cycles
Conjugate Unconjugated
Form Liquid
pH Range 7.5
Common Name PLK2
Molecular Weight (g/mol) 105.7 kDa
KinaseFamily PLK Kinase Family
Gene Symbol PLK2
Sequence Full length
Storage Requirements -80°C, Avoid Freeze/Thaw Cycles
Concentration See Label
Expression System Baculovirus
For Use With (Application) Kinase Assay
Name Human PLK2, GST Tag
Accession Number Q9NYY3
Regulatory Status RUO
Purification Method Purified
Gene Alias h PLK-2; hPlk2; hSNK; Plk2; PLK-2; polo like kinase 2; polo-like kinase 1; polo-like kinase 2; Serine/threonine-protein kinase PLK2; serine/threonine-protein kinase SNK; Serum-inducible kinase; SNK
Product Type Protein
Gene ID (Entrez) 10769
Formulation 50mM tris with 0.02% Triton X-100, 150mM NaCl, 0.5mM EDTA, 50% glycerol, 2mM DTT and no preservative; pH 7.5
Protein Tag GST-tag
Species Human
Recombinant Recombinant
15

R&D Systems™ Recombinant Human Complement Component C1s Protein
GSA_VA

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity