Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Conjugate
- (2)
- (2)
- (32)
- (957)
Recombinant
- (871)
For Use With (Application)
- (4)
- (9)
- (126)
- (331)
- (354)
- (12)
- (6)
- (6)
- (1)
- (42)
- (1)
- (269)
- (6)
- (4)
- (18)
- (19)
- (3)
Species
- (1)
- (4)
- (667)
- (21)
- (1)
- (2)
Form
- (608)
- (61)
- (4)
- (2)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
1
–
15
of
1,918
results
| Conjugate | Unconjugated |
|---|---|
| Form | Powder |
| Product Type | Recombinant Proteins |
| For Use With (Application) | Organoid Expansion |
| Species | Human |
| Recombinant | Recombinant |
| Conjugate | Unconjugated |
|---|---|
| Form | Powder |
| Product Type | Recombinant Proteins |
| For Use With (Application) | Organoid Expansion |
| Species | Human |
| Recombinant | Recombinant |
Novus Biologicals™ Recombinant Human Tyrosine Hydroxylase His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: Western Blot, Immunohistochemistry-Paraffin, SDS-Page
| Formulation | 300 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO4, 1.47 mM KH2PO4, 5% glycerol, 1 mM DTT, pH 7.4 |
|---|---|
| Gene ID (Entrez) | 7054 |
| Storage Requirements | −80°C. Avoid freeze-thaw cycles. |
Novus Biologicals™ Recombinant Mouse Tyrosine Hydroxylase His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
Invitrogen™ Human Tyrosine Hydroxylase (aa 406-517) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | EFGLCKQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDEL |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human Tyrosine Hydroxylase (aa 406-517) Control Fragment |
| Recombinant | Recombinant |
Invitrogen™ Human Tyrosine Hydroxylase (aa 465-528) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human Tyrosine Hydroxylase (aa 465-528) Control Fragment |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Mouse Flt-3 Ligand/FLT3L Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
| Purity or Quality Grade | 97%, by SDS-PAGE under reducing conditions and visualized by silver stain. |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | FL, FLG3L, Flt3 ligand, Flt3L, FLT3LG, fms-related tyrosine kinase 3 ligand, SL cytokine |
| Molecular Weight (g/mol) | 18 kDa |
| Gene ID (Entrez) | 14256 |
| Source | Mouse myeloma cell line,NS0-derived mouse Flt-3 Ligand/FLT3L protein Gly27-Arg188 |
| Recombinant | Recombinant |
| Name | Flt-3 Ligand |
Gibco™ Human Flt-3 Ligand (FLT3L) Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Protein Family | Growth Factors & Receptors |
|---|---|
| Purity or Quality Grade | >95% by SDS-PAGE |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Common Name | FLT3LG |
| Molecular Weight (g/mol) | 35 kDa |
| Endotoxin Level | <0.1 ng/μg |
| Activity | ED50 ≤ 5 ng/mL; determined by the dose-dependent proliferation of human OCI-AML5 cells. |
| Endotoxin Concentration | <0.1 ng/μg |
| Expression System | HEK293 cells |
| For Use With (Application) | Bioactivity |
| Name | Human Flt-3 Ligand (FLT3L) |
| Purification Method | Purified |
| Gene Alias | FL; Flt 3 ligand; Flt3; Flt3 L; Flt3 ligand; Flt3l; Flt3lg; fms related receptor tyrosine kinase 3 ligand; fms related tyrosine kinase 3 ligand; FMS-like tyrosine kinase 3 ligand; fms-related tyrosine kinase 3; fms-related tyrosine kinase 3 ligand; H-FLT-3-L; Ly72L; M-FLT-3-L; NEWGENE_2322792; SL cytokine |
| Protein Form | Recombinant, Ligand |
| Biological Activity | ED50 ≤ 5 ng/mL; determined by the dose-dependent proliferation of human OCI-AML5 cells. |
| Formulation | Protein with no preservative |
| Classification | Carrier-Free |
| Research Category | Signal Transduction, Stem Cell Research, Oncology |
| Species | Human |
| Recombinant | Recombinant |
| Shipping Condition | Wet Ice |
| Content And Storage | 4°C |
| Gene Symbol | FLT3LG |
| Sequence | TQDCSFQHSP ISSDFAVKIR ELSDYLLQDY PVTVASNLQD EELCGGLWRL VLAQRWMERL KTVAGSKMQG LLERVNTEIH FVTKCAFQPP PSCLRFVQTN ISRLLQETSE QLVALKPWIT RQNFSRCLEL QCQPDSSTLP PPWSPRPLEA TAPTAPQP |
| Storage Requirements | 4°C |
| Protein Subtype | FLT-3 Ligand |
| Accession Number | P49771 |
| Regulatory Status | RUO |
| Reactivity | Human |
| Product Type | Protein |
| Gene ID (Entrez) | 2323 |
| Product Line | Gibco |
Invitrogen™ Human CLK1, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Shipping Condition | Dry Ice |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | CLK1 |
| Molecular Weight (g/mol) | 70.1 kDa |
| KinaseFamily | CLK Kinase Family |
| Gene Symbol | CLK1 |
| Sequence | 129-484 |
| Storage Requirements | -80°C, Avoid Freeze/Thaw Cycles |
| Concentration | See Label |
| Expression System | E. coli |
| For Use With (Application) | Kinase Assay |
| Name | Human CLK1, GST Tag |
| Accession Number | P49759 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | CDC like kinase 1; CDC28/CDC2-like kinase; CDC-like kinase 1; CLK; CLK/STY; CLK1; Dual specificity protein kinase CLK1; Protein kinase CLK1; protein kinase STY; protein tyrosine kinase STY; Sty |
| Protein Form | Recombinant, Catalytic |
| Product Type | Protein |
| Gene ID (Entrez) | 1195 |
| Formulation | 50mM tris with 0.05mM EDTA, 0.05% Triton X-100, 50% glycerol, 2mM DTT, 150mM NaCl and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Mouse Ephrin-A1 Fc Chimera Biotinylated Protein
Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Binding Activity