Cresols
eMolecules 535924-73-3 | 3-ethoxyazetidine hydrochloride | MFCD06804556 | 1g
Pharmablock - Stock | 3-ethoxyazetidine hydrochloride | 1g | 521642672 | PBZLA038-1 | 535924-73-3 | MFCD06804556 | 137.610 | C5H12ClNO
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Medchemexpress LLC Potassium hydrogen phthalate | 877-24-7 | MFCD00013070 | 100.0% | 204.22 g/mol | C8H5KO4 | 25g
Potassium 2-carboxybenzoate is a biochemical reagent that can be used as a biological material or organic compound for life science related research
Medchemexpress LLC Erinacine P | 291532-17-7 | 403923 | 492.60 | 1 MG
Erinacine P is a cyathane-type diterpenoid antibacterial agent. It is isolated from the biosynthesis of mycelia and submerged cultures of Hericium erinaceum. Erinacine P serves as a precursor for the production of important active components such as Erinacine C, A and B, and exhibits significant antibacterial activity against Aliivibrio fischeri.
- Cyathane-type diterpenoid antibacterial agent.
- Isolated from the biosynthesis of mycelia and submerged cultures of Hericium erinaceum.
- Precursor for Erinacine C, A, and B.
- Exhibits significant antibacterial activity against Aliivibrio fischeri.
Medchemexpress LLC NPR2 Human P. past 100ug
NPR2 Protein Human (P pastoris His) serves as the receptor for C-type natriuretic peptide NPPC/CNP activating guanylate cyclase upon ligand binding NPR2 potentially regulates skeletal growth indicating involvement in bone development Its interaction with C-type natriuretic peptide highlights its significance in mediating cellular responses especially in signaling pathways influencing skeletal growth dynamics NPR2 Protein Human (P pastoris His) is the recombinant human-derived Atrial natriuretic peptide receptor 2/NPR2 expressed by P pastoris with N-His labeled tag
eMolecules 2628-17-3 | 4-Vinylphenol 10 wt.% In propylene glycol | Oakwood Chemical | MFCD00017593 | 120.151 | C8H8O | 0.000 | Oc1ccc(C=C)cc1 | 25g | 537718731
4-Vinylphenol 10 wt.% In propylene glycol | Oakwood Chemical | 2628-17-3 | MFCD00017593 | 120.151 | C8H8O | 0.000 | Oc1ccc(C=C)cc1 | 25g | 537718731
Medchemexpress LLC Serpin A3N Mouse P 50ug
Recombinant mouse Serpin A3N is a purified, His-tagged serine protease inhibitor expressed in Pichia pastoris for research applications. This reagent is intended for biochemical characterization, antibody development, and cell-based assays; it is supplied in a 50 μg pack with reported purity of ~92% and a molecular weight of ~46.8 kDa.
- Suitable for biochemical assays and functional studies.
- Useful for antibody generation and validation.
- Expressed in Pichia pastoris for eukaryotic processing.
- Includes N-terminal 6xHis tag for affinity purification or detection.
- High reported purity (~92%) and defined molecular weight (~46.8 kDa).
- Small pack size (50 μg) for pilot experiments and method development.
Medchemexpress LLC Methyl p-coumarate | 3943-97-3 | 178.18 | 5 G
Methyl p-coumarate | 3943-97-3 | 178.18 | 5 G
Medchemexpress LLC 3-(2-Pyridyldithio)propanoic acid | 68617-64-1 | 99.5% | 1 G
3-(2-Pyridyldithio)propanoic acid is an alkyl chain-based PROTAC linker designed for use in the synthesis of PROTACs. PROTACs are molecules that contain two different ligands connected by a linker, utilizing the intracellular ubiquitin-proteasome system to selectively degrade target proteins.
- Alkyl chain-based PROTAC linker
- Used in the synthesis of PROTACs
- For research use only
Medchemexpress LLC PfLDH P. falciparum 50ug | 50ug
The pfHPRT (Plasmodium falciparum hypoxanthine-guanine phosphoribosyltransferase) protein is a member of the LDH/MDH (lactate dehydrogenase/malate dehydrogenase) superfamily It plays a crucial role in the purine metabolism salvage pathway of the malaria-causing parasite Plasmodium falciparum PfLDH Protein P falciparum (His) is the recombinant PfLDH protein expressed by E coli with C-His labeled tag
Medchemexpress LLC C-Type Natriuretic Peptide (1-53), human TFA | 141294-77-1 | 99.94% | 5801.77 | 10 MG
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. This natriuretic peptide family peptide is involved in the maintenance of electrolyte-fluid balance and vascular tone.
- Molecular formula: C251H417N81O71S3.xC2HF3O2
- Appearance: Solid
- Color: White to off-white
- Sequence (shortened): DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)
- Solubility: H2O: 50 mg/mL (ultrasonic needed)
- Target: Angiotensin receptor
- Pathway: GPCR/G protein
Medchemexpress LLC Camptothecin-20S-O-p 25mg | 194414-69-2 | 25 MG
Camptothecin-20(S)-O-propionate (CZ48) is the C20-propionate ester of camptothecin that functions as a topoisomerase I inhibitor and has reported antitumor activity in animal models. It is provided as a solid and as prepared solutions for research use, with recommended storage to maintain stability.
- Acts as a topoisomerase I inhibitor
- Demonstrated antitumor activity in breast and prostate carcinoma models
- Available as solid and 10 mM DMSO solution formulations
- High purity suitable for research (reported ~99.5%)
- Stable under recommended storage: powder -20°C for long term, solvent -80°C
Medchemexpress LLC N-(p-Coumaroyl) Serotonin | 68573-24-0 | 99.0% | 50 MG
N-(p-Coumaroyl) Serotonin is a selective inhibitor of PDGFRβ, ERK1/2, and caspase-8, exhibiting antioxidant, anti-atherosclerotic, and anti-inflammatory properties. It inhibits glioblastoma cells and demonstrates anti-inflammatory activity in RAW264.7 cells. The compound works by inhibiting PDGF signaling, blocking Ca2+ influx, and inducing apoptosis, making it suitable for glioblastoma and atherosclerosis research.
- Selective inhibitor of PDGFRβ, ERK1/2, and caspase-8
- Possesses antioxidant, anti-atherosclerotic, and anti-inflammatory properties
- Inhibits glioblastoma cells
- Reduces PDGF signaling and blocks Ca2+ influx
- Induces apoptosis through caspase-8 activation
- Improves atherosclerosis and aortic wall enlargement
Medchemexpress LLC NPR2 Human P. past 10ug
NPR2 Protein Human (P pastoris His) serves as the receptor for C-type natriuretic peptide NPPC/CNP activating guanylate cyclase upon ligand binding NPR2 potentially regulates skeletal growth indicating involvement in bone development Its interaction with C-type natriuretic peptide highlights its significance in mediating cellular responses especially in signaling pathways influencing skeletal growth dynamics NPR2 Protein Human (P pastoris His) is the recombinant human-derived Atrial natriuretic peptide receptor 2/NPR2 expressed by P pastoris with N-His labeled tag