
Cell Culture Reagents, Antibiotics and Supplements
Products designed for cell culture processes including, but not limited to dissociation, decontamination, and growth stimulation.

Antibiotics
(6,492)

Cell Culture Growth Factors and Hormones
(2,276)

Additional Cell Culture Reagents and Supplements
(999)

Nutritional Supplements
(443)

Dissociation Reagents
(244)

Contaminant Detection and Removal Reagents
(54)

Growth Factor Products
(33)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

1,021
–
1,035
of
9,701
results
Invitrogen™ Human NCF2 Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | MLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGRLFRPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFAPLQPQAA |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human NCF2 Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human MRE11 (aa 534-673) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | EESASAFSADDLMSIDLAEQMANDSDDSISAATNKGRGRGRGRRGGRGQNSASRGGSQRGRADTGLETSTRSRNSKTAVSASRNMSIIDAFKSTRQQPSRNVTTKNYSEVIEVDESDVEEDIFPTTSKTDQRWSSTSSSK |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human MRE11 (aa 534-673) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human MMGT1 (aa 68-123) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | KDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKL |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human MMGT1 (aa 68-123) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human STAT1 (aa 94-230) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | FQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human STAT1 (aa 94-230) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human EFHC2 (aa 17-100) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | KEKFHKSQHWGFCNNVMMLVSDEKPGIGGEPLLGQKIKPKCSIYPKGDGSDVPSWVAFDKQVLSFDAYLEEEVLDKSQTNYRIR |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human EFHC2 (aa 17-100) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human ZFAND6 (aa 43-112) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | SSNGRISPPATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDK |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human ZFAND6 (aa 43-112) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human CNTNAP4 (aa 1198-1239) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | TESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSD |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human CNTNAP4 (aa 1198-1239) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human CYP2U1 (aa 279-330) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | LPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFIDMYLLHMEEERK |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human CYP2U1 (aa 279-330) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human ANO8 (aa 920-994) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | REHDSGGREEARAEGSGLDPATSSEKASAKAKGSTAGGHGPERPKRPGSLLAPNNVMKLKQIIPLQGKFLSSGAT |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human ANO8 (aa 920-994) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human SPATA7 (aa 271-344) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | QRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRA |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human SPATA7 (aa 271-344) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human SEMA4G (aa 32-105) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | ATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCH |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human SEMA4G (aa 32-105) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human LRRC59 (aa 187-231) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | LRKREKAEEKERRRKEYDALKAAKREQEKKPKKEANQAPKSKSGS |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human LRRC59 (aa 187-231) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human RPS25 (aa 62-125) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | VPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human RPS25 (aa 62-125) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human ARGBP2 (aa 769-857) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | PERNSSLRALRRSPLHQPLHPLPPDGAIHCPPYQNDCGRMPRSASFQDVDTANSSCHHQDRGGALQDRESPRSYSSTLTDMGRSAPRER |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human ARGBP2 (aa 769-857) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human GluR1 (aa 344-406) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | VRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQN |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human GluR1 (aa 344-406) Control Fragment |
Recombinant | Recombinant |