accessibility menu, dialog, popup

UserName
Viewing profile as user:

Sera

Animal sera and other, related sera-derived products suitable for a variety of cell culture-related research and educational purposes.
Human Sera (3,012)
Fetal Bovine Sera (374)
Mouse Sera (209)
Goat Sera (116)
Rabbit Sera (115)
Monkey Sera (92)
Horse and Equine Sera (84)
Serum Substitutes (80)
Feline Sera (73)
Porcine Sera (69)
Rat Sera (65)
Calf Bovine Sera (61)
Fetal Bovine Replacement Sera (48)
Adult Bovine Sera (36)
Newborn Bovine Sera (34)
Sheep Sera (27)
Canine Sera (21)
Guinea Pig Sera (17)
Hamster Sera (16)
Chicken Sera (14)
Deer Sera (1)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

special offers

  • (2)
  • (6)
  • (6)

brands

  • (5)
  • (3)
  • (2)
  • (38)
  • (7)
  • (14)
  • (4)
  • (1)
  • (5)
  • (7)
  • (9)
  • (1)
  • (3)
  • (1)
  • (27)
  • (8)
  • (7)
  • (35)
  • (10)
  • (2,832)
  • (1)
  • (1)
  • (1)
  • (5)
  • (1)
  • (1)
  • (1)
  • (6)
  • (1)
  • (3)
  • (7)
  • (37)
  • (1)
  • (7)
  • (2)
  • (171)
  • (1)
  • (1)
  • (5)
  • (16)
  • (1)
  • (3)
  • (5)
  • (1)
  • (2)
  • (4)
  • (2)
  • (14)
  • (1)
  • (1)
  • (2)
  • (16)
  • (83)
  • (2)
  • (6)
  • (1)
  • (1)
  • (7)
  • (5)
  • (117)
  • (5)
  • (10)
  • (30)
  • (1)
  • (34)
  • (45)
  • (8)
  • (2)
  • (19)
  • (1)
  • (1)
  • (12)
  • (1)
  • (3)
  • (10)
  • (5)
  • (3)
  • (1)
  • (3)
  • (10)
  • (3)
  • (5)
  • (8)
  • (1)
  • (15)
  • (3)
  • (8)
  • (2)
  • (3)
  • (5)
  • (113)
  • (4)
  • (19)
  • (2)
  • (1)
  • (3)
  • (3)
  • (3)
  • (1)
  • (19)
  • (1)
  • (3)
  • (1)
  • (1)
  • (1)
  • (8)
  • (4)
  • (1)
  • (2)

special interests

  • (26)
  • (28)
  • (68)
  • (56)
  • (3,475)

Quantity

  • (6)
  • (8)
  • (1)
  • (1)
  • (1)
  • (2)
  • (9)
Show all

Product Type

  • (6)
  • (4)
  • (21)
  • (2)
  • (1)
  • (1)
  • (2)
Show all

Sterility

  • (1)
  • (241)
  • (16)

Sterilization Method

  • (8)
  • (16)
  • (8)
  • (1)
  • (6)
  • (4)
  • (3)
Show all

Country of Origin

  • (20)
  • (12)
  • (1)
  • (3)
  • (6)
  • (43)
  • (27)
Show all

Form

  • (22)
  • (149)
  • (29)
  • (4)
  • (7)

Serum Treatment

  • (2)
  • (1)
  • (2)
  • (3)
  • (5)
  • (1)
  • (26)
Show all

Age

  • (1)
  • (4)
  • (1)
  • (6)
  • (1)
  • (1)
  • (2)
Show all

Format

  • (52)
  • (24)

Conjugate

  • (2)
181 – 195 of 4,385 results
182

Cytiva HyClone™ Irradiated Calf Serum, U.S. Origin

Collected by venipuncture from formula-fed veal calves, which produce exceptionally high levels of transferrin

183

Cytiva HyClone™ Calf Serum (New Zealand)

USDA Safety Testing Included Yes
Content And Storage Sera should be stored at -10°C or lower. Once thawed, sera should be stored at 2° to 8°C.
Description Calf Serum (New Zealand)
Mycoplasma Detected Yes
Additional Assays Albumin,Iron,Lactate Dehydrogenase,Calcium,Chloride,pH,Gamma Globulin,Glucose,SGPT,Inorganic Phosphorus,TIBC,Alkaline Phosphatase,Total Bilirubin,Total Protein,Blood Urea Nitrogen,Calcium,Chloride,Creatinine,Gamma Globulin,Glucose,IgG,Inorganic Phosphorus
Tested For Bluetongue,Bovine Adenovirus,Bovine Parvovirus,Bovine RSV,BVDV,Cytopathogenic Agents,Hemadsorbing Agents,Rabies Virus,Reovirus
Endotoxin Concentration ≤ 25 EU/mL
Certifications/Compliance USDA Regulations
Sterility Sterile
184

Cytiva Life Sciences™ HyClone™ 500 mL Defined Fetal Bovine Serum Australian Origin

Our highest quality FBS, HyClone™ AU-origin defined FBS is proprietary serial 40 nm-filtered, virus-tested to meet 9 CFR, with an extensive biochemical profile.

Product Type Fetal Bovine Serum
Volume (Metric) 500 mL
Country of Origin Australia
185

Cytiva Life Sciences™ Hyclone™ 100 mL Defined Fetal Bovine Serum (FBS), New Zealand Origin

Our highest quality FBS, HyClone™ NZ-origin Defined FBS is proprietary serial 40 nm-filtered, virus-tested to meet 9 CFR, with an extensive biochemical profile.

Product Type Fetal Bovine Serum
Volume (Metric) 100 mL
Country of Origin New Zealand
186

Cytiva Life Sciences™ Hyclone™ 500 mL Defined Fetal Bovine Serum (FBS), New Zealand Origin

Our highest quality FBS, HyClone™ NZ-origin Defined FBS is proprietary serial 40 nm-filtered, virus-tested to meet 9 CFR, with an extensive biochemical profile.

Product Type Fetal Bovine Serum
Volume (Metric) 500 mL
Country of Origin New Zealand
187

Cytiva Life Sciences™ HyClone™ 50 mL Defined Fetal Bovine Serum, Australian Origin

Our highest quality FBS, HyClone™ AU-origin defined FBS is proprietary serial 40 nm-filtered, virus-tested to meet 9 CFR, with an extensive biochemical profile.

Product Type Fetal Bovine Serum
Volume (Metric) 50 mL
Country of Origin Australia
188

Cytiva HyClone™ Characterized Fetal Bovine Serum (New Zealand)

Enhance growth of cells with New Zealand sourced HyClone™ Characterized Fetal Bovine Serum.

USDA Safety Testing Included USDA Inspected
Content And Storage Store at or below -10°C
Sterilization Method Sequential-filtered, 100 nm
Product Type Fetal Bovine Serum
Endotoxin Concentration ≤ 20 EU/mL
Grade Characterized
Sterility Sterile
Country of Origin New Zealand
Product Line HyClone™
Hemoglobin Concentration ≤ 25 mg/dL
189

Cytiva Life Sciences™ HyClone™ 500 mL Irradiated Defined Fetal Bovine Serum Australian Origin

Our highest quality FBS, HyClone™ AU-origin defined FBS is proprietary serial 40 nm-filtered, virus-tested to meet 9 CFR, with an extensive biochemical profile.

Product Type Fetal Bovine Serum
Volume (Metric) 500 mL
Country of Origin Australia
Product Line HyClone
190

SouthernBiotech™ Normal Donkey Serum
SDP

SouthernBiotech normal sera are useful as blocking reagents in a variety of immunoassays.

191

SouthernBiotech™ Normal Rabbit Sera
SDP

Processed to prevent minimal hemolysis and filtered to 0.2μm

192

Invitrogen™ Normal Mouse Serum, eBioscience™

Mouse Control

ENCOMPASS_PREFERRED
Content And Storage 4°C
Form Liquid
Concentration Conc. Not Determined
193

Invitrogen™ Normal Mouse Serum

Mouse Control

ENCOMPASS_PREFERRED
Content And Storage 4°C
Form Lyophilized
Concentration Conc. Not Determined
194

Invitrogen™ Human Complement C3 (aa 1259-1401) Control Fragment Recombinant Protein

Recombinant Protein

ENCOMPASS_PREFERRED
Regulatory Status RUO
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Conjugate Unconjugated
Form Liquid
Formulation 1 M urea, PBS with no preservative; pH 7.4
Sequence QRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMS
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay,Control
Name Human Complement C3 (aa 1259-1401) Control Fragment
Recombinant Recombinant
195

Invitrogen™ Human Complement C5 (aa 1302-1432) Control Fragment Recombinant Protein

Recombinant Protein

ENCOMPASS_PREFERRED
Regulatory Status RUO
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Conjugate Unconjugated
Form Liquid
Formulation 1 M urea, PBS with no preservative; pH 7.4
Sequence LLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGI
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay,Control
Name Human Complement C5 (aa 1302-1432) Control Fragment
Recombinant Recombinant